Lineage for d1cvsb_ (1cvs B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401434Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2401435Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries)
  8. 2401459Domain d1cvsb_: 1cvs B: [25499]
    Other proteins in same PDB: d1cvsc1, d1cvsc2, d1cvsd1, d1cvsd2
    complexed with so4

Details for d1cvsb_

PDB Entry: 1cvs (more details), 2.8 Å

PDB Description: crystal structure of a dimeric fgf2-fgfr1 complex
PDB Compounds: (B:) fibroblast growth factor 2

SCOPe Domain Sequences for d1cvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvsb_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsa

SCOPe Domain Coordinates for d1cvsb_:

Click to download the PDB-style file with coordinates for d1cvsb_.
(The format of our PDB-style files is described here.)

Timeline for d1cvsb_: