Lineage for d1cvsa_ (1cvs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791843Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2791844Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries)
  8. 2791867Domain d1cvsa_: 1cvs A: [25498]
    Other proteins in same PDB: d1cvsc1, d1cvsc2, d1cvsd1, d1cvsd2
    complexed with so4

Details for d1cvsa_

PDB Entry: 1cvs (more details), 2.8 Å

PDB Description: crystal structure of a dimeric fgf2-fgfr1 complex
PDB Compounds: (A:) fibroblast growth factor 2

SCOPe Domain Sequences for d1cvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvsa_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsa

SCOPe Domain Coordinates for d1cvsa_:

Click to download the PDB-style file with coordinates for d1cvsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cvsa_: