Lineage for d2bfha_ (2bfh A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (3 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) 
Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries) 
Domain d2bfha_: 2bfh A: [25497]
Details for d2bfha_
PDB Entry: 2bfh (more details), 2.5 Å
PDB Description: crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
PDB Compounds: (A:) basic fibroblast growth factorSCOPe Domain Sequences for d2bfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfha_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamke
dgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
flpmsaks
SCOPe Domain Coordinates for d2bfha_:
Click to download the PDB-style file with coordinates for d2bfha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bfha_:
- d2bfha_ first appeared (with stable ids) in SCOP 1.55, called d2bfh__
- d2bfha_ appears in SCOPe 2.07
View in 3D