Lineage for d1ev2a_ (1ev2 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59890Protein Basic FGF (FGF2) [50355] (1 species)
  7. 59891Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)
  8. 59900Domain d1ev2a_: 1ev2 A: [25493]
    Other proteins in same PDB: d1ev2e1, d1ev2e2, d1ev2f1, d1ev2f2, d1ev2g1, d1ev2g2, d1ev2h1, d1ev2h2

Details for d1ev2a_

PDB Entry: 1ev2 (more details), 2.2 Å

PDB Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)

SCOP Domain Sequences for d1ev2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev2a_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens)}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsak

SCOP Domain Coordinates for d1ev2a_:

Click to download the PDB-style file with coordinates for d1ev2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ev2a_: