Lineage for d1bfc__ (1bfc -)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) 
Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) 
Domain d1bfc__: 1bfc - [25492]
Details for d1bfc__
PDB Entry: 1bfc (more details), 2.2 Å
PDB Description: basic fibroblast growth factor complexed with heparin hexamer fragment
SCOP Domain Sequences for d1bfc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfc__ b.42.1.1 (-) Basic FGF (FGF2) {Human (Homo sapiens)}
pkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamked
grllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkailf
lpms
SCOP Domain Coordinates for d1bfc__:
Click to download the PDB-style file with coordinates for d1bfc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfc__:
- d1bfc__ first appeared (with stable ids) in SCOP 1.55
- d1bfc__ appears in SCOP 1.67
- d1bfc__ appears in SCOP 1.71
- d1bfc__ appears in the current release, SCOPe 2.08, called d1bfca_
View in 3D