SCOP 1.69: Domain d1fga__: 1fga -

Lineage for d1fga__ (1fga -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)

6. Protein Basic FGF (FGF2) [50355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)

8. Domain d1fga__: 1fga - [25491]

Details for d1fga__

PDB Entry: 1fga, 2.2 Å

PDB Description: refinement of the structure of human basic fibroblast growth factor at 1.6 angstroms resolution and analysis of presumed heparin binding sites by selenate substitution

SCOP Domain Sequences for d1fga__:

Sequence; same for both SEQRES and ATOM records:

>d1fga__ b.42.1.1 (-) Basic FGF (FGF2) {Human (Homo sapiens)}
pkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamked
grllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkailf
lpms

Timeline for d1fga__:

• d1fga__ first appeared (with stable ids) in SCOP 1.55
  
• d1fga__ appears in SCOP 1.67
  
• d1fga__ appears in SCOP 1.71
  
• d1fga__ appears in the current release, SCOPe 2.08, called d1fgaa_