SCOPe 2.08: Domain d1fgaa_: 1fga A:

Lineage for d1fgaa_ (1fga A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Basic FGF (FGF2) [50355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50356] (21 PDB entries)

8. Domain d1fgaa_: 1fga A: [25491]
   complexed with bme, se4

Details for d1fgaa_

PDB Entry: 1fga, 2.2 Å

PDB Description: refinement of the structure of human basic fibroblast growth factor at 1.6 angstroms resolution and analysis of presumed heparin binding sites by selenate substitution

PDB Compounds: (A:) basic fibroblast growth factor

SCOPe Domain Sequences for d1fgaa_:

Sequence; same for both SEQRES and ATOM records:

>d1fgaa_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
pkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamked
grllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkailf
lpms

Timeline for d1fgaa_:

• d1fgaa_ first appeared (with stable ids) in SCOP 1.55, called d1fga__
  
• d1fgaa_ appears in SCOPe 2.07