Lineage for d1bff__ (1bff -)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.42: beta-Trefoil [50352] (6 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins) Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) 
Domain d1bff__: 1bff - [25489]
154 residue form
complexed with bme, po4
Details for d1bff__
PDB Entry: 1bff (more details), 2 Å
PDB Description: the 154 amino acid form of human basic fibroblast growth factor
SCOP Domain Sequences for d1bff__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bff__ b.42.1.1 (-) Basic FGF (FGF2) {Human (Homo sapiens)}
kdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamk
edgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkai
lflpmsaks
SCOP Domain Coordinates for d1bff__:
Click to download the PDB-style file with coordinates for d1bff__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bff__:
- d1bff__ first appeared (with stable ids) in SCOP 1.55
- d1bff__ appears in SCOP 1.63
- d1bff__ appears in SCOP 1.67
- d1bff__ appears in the current release, SCOPe 2.08, called d1bffa_
View in 3D