Lineage for d2fgf__ (2fgf -)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.42: beta-Trefoil [50352] (6 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) 
Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) 
Domain d2fgf__: 2fgf - [25487]
complexed with so4
Details for d2fgf__
PDB Entry: 2fgf (more details), 1.77 Å
PDB Description: three-dimensional structure of human basic fibroblast growth factor, a structural homolog of interleukin 1beta
SCOP Domain Sequences for d2fgf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgf__ b.42.1.1 (-) Basic FGF (FGF2) {Human (Homo sapiens)}
dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamke
dgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
flpmsak
SCOP Domain Coordinates for d2fgf__:
Click to download the PDB-style file with coordinates for d2fgf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fgf__:
- d2fgf__ first appeared (with stable ids) in SCOP 1.55
- d2fgf__ appears in SCOP 1.65
- d2fgf__ appears in SCOP 1.69
- d2fgf__ appears in the current release, SCOPe 2.08, called d2fgfa_
View in 3D