![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Thermochromatium tepidum [TaxId:1050] [50351] (1 PDB entry) |
![]() | Domain d1eysh1: 1eys H:59-259 [25484] Other proteins in same PDB: d1eysc_, d1eysh2, d1eysl_, d1eysm_ complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef |
PDB Entry: 1eys (more details), 2.2 Å
SCOPe Domain Sequences for d1eysh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum [TaxId: 1050]} pdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspd rpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepq irylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedk vcayyaggklyataeragpll
Timeline for d1eysh1: