Lineage for d1eysh1 (1eys H:59-259)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167245Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 167246Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 167247Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 167248Protein Photosynthetic reaction centre [50348] (3 species)
  7. 167293Species Thermochromatium tepidum [TaxId:1050] [50351] (1 PDB entry)
  8. 167294Domain d1eysh1: 1eys H:59-259 [25484]
    Other proteins in same PDB: d1eysc_, d1eysh2, d1eysl1, d1eysm1

Details for d1eysh1

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum}
pdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspd
rpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepq
irylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedk
vcayyaggklyataeragpll

SCOP Domain Coordinates for d1eysh1:

Click to download the PDB-style file with coordinates for d1eysh1.
(The format of our PDB-style files is described here.)

Timeline for d1eysh1: