SCOP 1.59: Domain d4rcrh1: 4rcr H:36-248

Lineage for d4rcrh1 (4rcr H:36-248)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)

8. Domain d4rcrh1: 4rcr H:36-248 [25483]
   Other proteins in same PDB: d4rcrh2, d4rcrl1, d4rcrm1

Details for d4rcrh1

PDB Entry: 4rcr, 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions

SCOP Domain Sequences for d4rcrh1:

Sequence; same for both SEQRES and ATOM records:

>d4rcrh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d4rcrh1:

• d4rcrh1 first appeared (with stable ids) in SCOP 1.55
  
• d4rcrh1 appears in SCOP 1.57
  
• d4rcrh1 appears in SCOP 1.61
  
• d4rcrh1 appears in the current release, SCOPe 2.08