SCOP 1.63: Domain d1ysth1: 1yst H:36-260

Lineage for d1ysth1 (1yst H:36-260)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)

8. Domain d1ysth1: 1yst H:36-260 [25482]
   Other proteins in same PDB: d1ysth2, d1ystl_, d1ystm_
   complexed with bcl, bph, mn, spo, u10

Details for d1ysth1

PDB Entry: 1yst, 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

SCOP Domain Sequences for d1ysth1:

Sequence; same for both SEQRES and ATOM records:

>d1ysth1 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya

Timeline for d1ysth1:

• d1ysth1 first appeared (with stable ids) in SCOP 1.55
  
• d1ysth1 appears in SCOP 1.61
  
• d1ysth1 appears in SCOP 1.65
  
• d1ysth1 appears in the current release, SCOPe 2.08