Lineage for d1ysth1 (1yst H:36-260)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111007Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 111008Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 111009Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 111010Protein Photosynthetic reaction centre [50348] (3 species)
  7. 111011Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)
  8. 111038Domain d1ysth1: 1yst H:36-260 [25482]
    Other proteins in same PDB: d1ysth2, d1ystl1, d1ystm1

Details for d1ysth1

PDB Entry: 1yst (more details), 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

SCOP Domain Sequences for d1ysth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysth1 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya

SCOP Domain Coordinates for d1ysth1:

Click to download the PDB-style file with coordinates for d1ysth1.
(The format of our PDB-style files is described here.)

Timeline for d1ysth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysth2