![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries) Uniprot P11846 |
![]() | Domain d1ysth1: 1yst H:36-260 [25482] Other proteins in same PDB: d1ysth2, d1ystl_, d1ystm_ complexed with bcl, bph, mn, spo, u10 |
PDB Entry: 1yst (more details), 3 Å
SCOPe Domain Sequences for d1ysth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysth1 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya
Timeline for d1ysth1: