SCOP 1.55: Domain d2rcrh1: 2rcr H:36-255

Lineage for d2rcrh1 (2rcr H:36-255)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (15 PDB entries)

8. Domain d2rcrh1: 2rcr H:36-255 [25481]
   Other proteins in same PDB: d2rcrh2, d2rcrl1, d2rcrm1

Details for d2rcrh1

PDB Entry: 2rcr, 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d2rcrh1:

Sequence; same for both SEQRES and ATOM records:

>d2rcrh1 b.41.1.1 (H:36-255) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaam

Timeline for d2rcrh1:

• d2rcrh1 appears in SCOP 1.57
  
• d2rcrh1 appears in the current release, SCOPe 2.08