Lineage for d2rcrh1 (2rcr H:36-255)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2052959Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
    Uniprot P11846
  8. 2053048Domain d2rcrh1: 2rcr H:36-255 [25481]
    Other proteins in same PDB: d2rcrh2, d2rcrl_, d2rcrm_
    complexed with bcl, bph, fe, uq

Details for d2rcrh1

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d2rcrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrh1 b.41.1.1 (H:36-255) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaam

SCOPe Domain Coordinates for d2rcrh1:

Click to download the PDB-style file with coordinates for d2rcrh1.
(The format of our PDB-style files is described here.)

Timeline for d2rcrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcrh2