SCOPe 2.08: Domain d1pssh1: 1pss H:36-248

Lineage for d1pssh1 (1pss H:36-248)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d1pssh1: 1pss H:36-248 [25479]
   Other proteins in same PDB: d1pssh2, d1pssl_, d1pssm_
   complexed with bcl, bph, crt, fe, u10; mutant

Details for d1pssh1

PDB Entry: 1pss, 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1pssh1:

Sequence; same for both SEQRES and ATOM records:

>d1pssh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d1pssh1:

• d1pssh1 first appeared (with stable ids) in SCOP 1.55
  
• d1pssh1 appears in SCOPe 2.07