Lineage for d1dv6t1 (1dv6 T:36-256)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14365Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 14366Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 14367Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 14368Protein Photosynthetic reaction centre [50348] (3 species)
  7. 14369Species Rhodobacter sphaeroides [TaxId:1063] [50350] (15 PDB entries)
  8. 14382Domain d1dv6t1: 1dv6 T:36-256 [25476]
    Other proteins in same PDB: d1dv6h2, d1dv6l1, d1dv6m1, d1dv6r1, d1dv6s1, d1dv6t2

Details for d1dv6t1

PDB Entry: 1dv6 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+

SCOP Domain Sequences for d1dv6t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv6t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1dv6t1:

Click to download the PDB-style file with coordinates for d1dv6t1.
(The format of our PDB-style files is described here.)

Timeline for d1dv6t1: