Lineage for d1dv3t1 (1dv3 T:36-256)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14365Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 14366Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 14367Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 14368Protein Photosynthetic reaction centre [50348] (3 species)
  7. 14369Species Rhodobacter sphaeroides [TaxId:1063] [50350] (15 PDB entries)
  8. 14378Domain d1dv3t1: 1dv3 T:36-256 [25472]
    Other proteins in same PDB: d1dv3h2, d1dv3l1, d1dv3m1, d1dv3r1, d1dv3s1, d1dv3t2

Details for d1dv3t1

PDB Entry: 1dv3 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-separated d+qaqb-state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1dv3t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv3t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1dv3t1:

Click to download the PDB-style file with coordinates for d1dv3t1.
(The format of our PDB-style files is described here.)

Timeline for d1dv3t1: