Lineage for d1ds8t1 (1ds8 T:36-256)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.41: PRC-barrel domain [50345] (1 superfamily)
core: barrel, partly opened; n*=5, S*=8; meanderSuperfamily b.41.1: PRC-barrel domain [50346] (5 families) 
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) Protein Photosynthetic reaction centre [50348] (4 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries)
Uniprot P11846
Domain d1ds8t1: 1ds8 T:36-256 [25470]
Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2
complexed with bcl, bph, cd, cl, fe2, lda, u10
Details for d1ds8t1
PDB Entry: 1ds8 (more details), 2.5 Å
PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+
PDB Compounds: (T:) reaction center protein h chainSCOPe Domain Sequences for d1ds8t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ds8t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
SCOPe Domain Coordinates for d1ds8t1:
Click to download the PDB-style file with coordinates for d1ds8t1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ds8t1:
View in 3D
