![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
![]() | Protein Photosynthetic reaction centre [50348] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries) |
![]() | Domain d1ds8t1: 1ds8 T:36-256 [25470] Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2 complexed with bcl, bph, cd, cl, fe2, lda, u10 |
PDB Entry: 1ds8 (more details), 2.5 Å
SCOP Domain Sequences for d1ds8t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ds8t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
Timeline for d1ds8t1: