Lineage for d1ds8t1 (1ds8 T:36-256)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298012Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 298013Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 298014Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 298015Protein Photosynthetic reaction centre [50348] (3 species)
  7. 298016Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)
  8. 298026Domain d1ds8t1: 1ds8 T:36-256 [25470]
    Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2
    complexed with bcl, bph, cd, cl, fe2, lda, u10

Details for d1ds8t1

PDB Entry: 1ds8 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor cd2+

SCOP Domain Sequences for d1ds8t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds8t1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOP Domain Coordinates for d1ds8t1:

Click to download the PDB-style file with coordinates for d1ds8t1.
(The format of our PDB-style files is described here.)

Timeline for d1ds8t1: