Class b: All beta proteins [48724] (177 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries) Uniprot P11846 |
Domain d1ds8h1: 1ds8 H:36-256 [25469] Other proteins in same PDB: d1ds8h2, d1ds8l_, d1ds8m_, d1ds8r_, d1ds8s_, d1ds8t2 complexed with bcl, bph, cd, cl, fe2, lda, u10 |
PDB Entry: 1ds8 (more details), 2.5 Å
SCOPe Domain Sequences for d1ds8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ds8h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
Timeline for d1ds8h1: