SCOP 1.61: Domain d1mpsh1: 1mps H:36-250

Lineage for d1mpsh1 (1mps H:36-250)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)

8. Domain d1mpsh1: 1mps H:36-250 [25468]
   Other proteins in same PDB: d1mpsh2, d1mpsl1, d1mpsm1

Details for d1mpsh1

PDB Entry: 1mps, 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)

SCOP Domain Sequences for d1mpsh1:

Sequence; same for both SEQRES and ATOM records:

>d1mpsh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1mpsh1:

• d1mpsh1 first appeared (with stable ids) in SCOP 1.55
  
• d1mpsh1 appears in SCOP 1.59
  
• d1mpsh1 appears in SCOP 1.63
  
• d1mpsh1 appears in the current release, SCOPe 2.08