![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries) Uniprot P11846 |
![]() | Domain d1aijt1: 1aij T:36-256 [25467] Other proteins in same PDB: d1aijh2, d1aijl_, d1aijm_, d1aijr_, d1aijs_, d1aijt2 complexed with bcl, bph, fe2, lda, u10 |
PDB Entry: 1aij (more details), 2.2 Å
SCOPe Domain Sequences for d1aijt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aijt1 b.41.1.1 (T:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
Timeline for d1aijt1: