SCOPe 2.05: Domain d1e6dh1: 1e6d H:36-250

Lineage for d1e6dh1 (1e6d H:36-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d1e6dh1: 1e6d H:36-250 [25465]
   Other proteins in same PDB: d1e6dh2, d1e6dl_, d1e6dm_
   complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d1e6dh1

PDB Entry: 1e6d, 2.3 Å

PDB Description: photosynthetic reaction center mutant with trp m115 replaced with phe (chain m, wm115f) phe m197 replaced with arg (chain m, fm197r)

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d1e6dh1:

Sequence; same for both SEQRES and ATOM records:

>d1e6dh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1e6dh1:

• d1e6dh1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6dh1 appears in SCOPe 2.04
  
• d1e6dh1 appears in SCOPe 2.06
  
• d1e6dh1 appears in the current release, SCOPe 2.08