SCOP 1.61: Domain d1qovh1: 1qov H:36-250

Lineage for d1qovh1 (1qov H:36-250)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)

8. Domain d1qovh1: 1qov H:36-250 [25464]
   Other proteins in same PDB: d1qovh2, d1qovl1, d1qovm1

Details for d1qovh1

PDB Entry: 1qov, 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)

SCOP Domain Sequences for d1qovh1:

Sequence; same for both SEQRES and ATOM records:

>d1qovh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1qovh1:

• d1qovh1 first appeared (with stable ids) in SCOP 1.55
  
• d1qovh1 appears in SCOP 1.59
  
• d1qovh1 appears in SCOP 1.63
  
• d1qovh1 appears in the current release, SCOPe 2.08