Lineage for d1fr3j_ (1fr3 J:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060894Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2060895Family b.40.6.1: Molybdate/tungstate binding protein MOP [50332] (1 protein)
    automatically mapped to Pfam PF03459
  6. 2060896Protein Molybdate/tungstate binding protein MOP [50333] (2 species)
    homohexamer: trimer of the C-terminal strand swapped dimers
  7. 2060928Species Sporomusa ovata [TaxId:2378] [50334] (1 PDB entry)
  8. 2060938Domain d1fr3j_: 1fr3 J: [25445]
    complexed with wo4

Details for d1fr3j_

PDB Entry: 1fr3 (more details), 1.5 Å

PDB Description: the high resolution structure of a molybdate binding protein from sporomusa ovata
PDB Compounds: (J:) molybdate/tungstate binding protein

SCOPe Domain Sequences for d1fr3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr3j_ b.40.6.1 (J:) Molybdate/tungstate binding protein MOP {Sporomusa ovata [TaxId: 2378]}
mkisgrnkleatvkeivkgtvmakivmdykgtelvaaitidsvadldlvpgdkvtalvka
temevlk

SCOPe Domain Coordinates for d1fr3j_:

Click to download the PDB-style file with coordinates for d1fr3j_.
(The format of our PDB-style files is described here.)

Timeline for d1fr3j_: