Lineage for d1fr3c_ (1fr3 C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14331Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 14332Family b.40.6.1: Molybdate/tungstate binding protein MOP [50332] (1 protein)
  6. 14333Protein Molybdate/tungstate binding protein MOP [50333] (1 species)
  7. 14334Species Sporomusa ovata [TaxId:2378] [50334] (1 PDB entry)
  8. 14337Domain d1fr3c_: 1fr3 C: [25438]

Details for d1fr3c_

PDB Entry: 1fr3 (more details), 1.5 Å

PDB Description: the high resolution structure of a molybdate binding protein from sporomusa ovata

SCOP Domain Sequences for d1fr3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr3c_ b.40.6.1 (C:) Molybdate/tungstate binding protein MOP {Sporomusa ovata}
mkisgrnkleatvkeivkgtvmakivmdykgtelvaaitidsvadldlvpgdkvtalvka
temevlk

SCOP Domain Coordinates for d1fr3c_:

Click to download the PDB-style file with coordinates for d1fr3c_.
(The format of our PDB-style files is described here.)

Timeline for d1fr3c_: