Lineage for d2prda_ (2prd A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060659Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2060660Protein Inorganic pyrophosphatase [50326] (7 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2060748Species Thermus thermophilus [TaxId:274] [50330] (1 PDB entry)
  8. 2060749Domain d2prda_: 2prd A: [25435]
    complexed with so4

Details for d2prda_

PDB Entry: 2prd (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from thermus thermophilus
PDB Compounds: (A:) pyrophosphate phosphohydrolase

SCOPe Domain Sequences for d2prda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prda_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 274]}
anlkslpvgdkapevvhmvievprgsgnkyeydpdlgaikldrvlpgaqfypgdygfips
tlaedgdpldglvlstypllpgvvvevrvvglllmedekggdakvigvvaedqrldhiqd
igdvpegvkqeiqhffetykaleakkgkwvkvtgwrdrkaaleevraciarykg

SCOPe Domain Coordinates for d2prda_:

Click to download the PDB-style file with coordinates for d2prda_.
(The format of our PDB-style files is described here.)

Timeline for d2prda_: