Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein Inorganic pyrophosphatase [50326] (7 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
Species Thermus thermophilus [TaxId:274] [50330] (1 PDB entry) |
Domain d2prda_: 2prd A: [25435] complexed with so4 |
PDB Entry: 2prd (more details), 2 Å
SCOPe Domain Sequences for d2prda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prda_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermus thermophilus [TaxId: 274]} anlkslpvgdkapevvhmvievprgsgnkyeydpdlgaikldrvlpgaqfypgdygfips tlaedgdpldglvlstypllpgvvvevrvvglllmedekggdakvigvvaedqrldhiqd igdvpegvkqeiqhffetykaleakkgkwvkvtgwrdrkaaleevraciarykg
Timeline for d2prda_: