Lineage for d1igp__ (1igp -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) 
Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein) Protein Inorganic pyrophosphatase [50326] (4 species) 
Species Escherichia coli [TaxId:562] [50329] (11 PDB entries) 
Domain d1igp__: 1igp - [25434]
Details for d1igp__
PDB Entry: 1igp (more details), 2.2 Å
PDB Description: x-ray crystallographic studies of recombinant inorganic pyrophosphatase from escherichia coli
SCOP Domain Sequences for d1igp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igp__ b.40.5.1 (-) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
SCOP Domain Coordinates for d1igp__:
Click to download the PDB-style file with coordinates for d1igp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1igp__:
- d1igp__ appears in SCOP 1.57
- d1igp__ appears in the current release, SCOPe 2.08, called d1igpa_
View in 3D