Lineage for d1mjxa_ (1mjx A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) 
Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein) Protein Inorganic pyrophosphatase [50326] (4 species) 
Species Escherichia coli [TaxId:562] [50329] (11 PDB entries) 
Domain d1mjxa_: 1mjx A: [25430]
Details for d1mjxa_
PDB Entry: 1mjx (more details), 2.15 Å
PDB Description: structure of inorganic pyrophosphatase mutant d65n
SCOP Domain Sequences for d1mjxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjxa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlslngdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
SCOP Domain Coordinates for d1mjxa_:
Click to download the PDB-style file with coordinates for d1mjxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mjxa_:
- d1mjxa_ appears in SCOP 1.57
- d1mjxa_ appears in the current release, SCOPe 2.08
View in 3D
