Lineage for d1mjxa_ (1mjx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790736Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2790776Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 2790796Domain d1mjxa_: 1mjx A: [25430]
    complexed with so4; mutant

Details for d1mjxa_

PDB Entry: 1mjx (more details), 2.15 Å

PDB Description: structure of inorganic pyrophosphatase mutant d65n
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1mjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjxa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlslngdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

SCOPe Domain Coordinates for d1mjxa_:

Click to download the PDB-style file with coordinates for d1mjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1mjxa_: