SCOPe 2.05: Domain d1ipwa_: 1ipw A:

Lineage for d1ipwa_ (1ipw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (7 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)

8. Domain d1ipwa_: 1ipw A: [25427]
   complexed with mg

Details for d1ipwa_

PDB Entry: 1ipw, 2.3 Å

PDB Description: inorganic pyrophosphatase from escherichia coli with three magnesium ions

PDB Compounds: (A:) soluble inorganic pyrophosphatase

SCOPe Domain Sequences for d1ipwa_:

Sequence, based on SEQRES records:

>d1ipwa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

Sequence, based on observed residues (ATOM records):

>d1ipwa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdedaklvavphsklskeydhikdv
ndlpellkaqiahffehykdlekwvkvegwenaeaakaeivasferak

Timeline for d1ipwa_:

• d1ipwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ipwa_ appears in SCOPe 2.04
  
• d1ipwa_ appears in SCOPe 2.06
  
• d1ipwa_ appears in the current release, SCOPe 2.08