Lineage for d2eipa_ (2eip A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14283Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 14284Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
  6. 14285Protein Inorganic pyrophosphatase [50326] (4 species)
  7. 14302Species Escherichia coli [TaxId:562] [50329] (11 PDB entries)
  8. 14310Domain d2eipa_: 2eip A: [25423]

Details for d2eipa_

PDB Entry: 2eip (more details), 2.2 Å

PDB Description: inorganic pyrophosphatase

SCOP Domain Sequences for d2eipa_:

Sequence, based on SEQRES records: (download)

>d2eipa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

Sequence, based on observed residues (ATOM records): (download)

>d2eipa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdgedaklvavphsklskeydhikd
vndlpellkaqiahffehykdlewvkvegwenaeaakaeivasferak

SCOP Domain Coordinates for d2eipa_:

Click to download the PDB-style file with coordinates for d2eipa_.
(The format of our PDB-style files is described here.)

Timeline for d2eipa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eipb_