Lineage for d2eipa_ (2eip A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052343Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2052344Protein Inorganic pyrophosphatase [50326] (7 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2052384Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 2052399Domain d2eipa_: 2eip A: [25423]

Details for d2eipa_

PDB Entry: 2eip (more details), 2.2 Å

PDB Description: inorganic pyrophosphatase
PDB Compounds: (A:) soluble inorganic pyrophosphatase

SCOPe Domain Sequences for d2eipa_:

Sequence, based on SEQRES records: (download)

>d2eipa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferak

Sequence, based on observed residues (ATOM records): (download)

>d2eipa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdgedaklvavphsklskeydhikd
vndlpellkaqiahffehykdlewvkvegwenaeaakaeivasferak

SCOPe Domain Coordinates for d2eipa_:

Click to download the PDB-style file with coordinates for d2eipa_.
(The format of our PDB-style files is described here.)

Timeline for d2eipa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eipb_