Lineage for d1mjwb_ (1mjw B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060659Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2060660Protein Inorganic pyrophosphatase [50326] (7 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2060700Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 2060712Domain d1mjwb_: 1mjw B: [25420]
    complexed with so4; mutant

Details for d1mjwb_

PDB Entry: 1mjw (more details), 1.95 Å

PDB Description: structure of inorganic pyrophosphatase mutant d42n
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1mjwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjwb_ b.40.5.1 (B:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvnrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

SCOPe Domain Coordinates for d1mjwb_:

Click to download the PDB-style file with coordinates for d1mjwb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjwb_: