SCOPe 2.07: Domain d4pwzb1: 4pwz B:23-161

Lineage for d4pwzb1 (4pwz B:23-161)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families)

5. Family c.51.2.0: automated matches [232575] (1 protein)
   not a true family

6. Protein automated matches [232576] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256379] (2 PDB entries)

8. Domain d4pwzb1: 4pwz B:23-161 [254101]
   Other proteins in same PDB: d4pwza2, d4pwzb2, d4pwzb3
   automated match to d2ivza2
   complexed with gol, mes, peg, so4

Details for d4pwzb1

PDB Entry: 4pwz, 1.73 Å

PDB Description: Crystal structure of TolB protein from Yersinia pestis CO92

PDB Compounds: (B:) protein tolb

SCOPe Domain Sequences for d4pwzb1:

Sequence; same for both SEQRES and ATOM records:

>d4pwzb1 c.51.2.0 (B:23-161) automated matches {Yersinia pestis [TaxId: 214092]}
vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
ysahtvsdevfekltgikg

Timeline for d4pwzb1:

• d4pwzb1 first appeared in SCOPe 2.04
  
• d4pwzb1 appears in SCOPe 2.06
  
• d4pwzb1 appears in the current release, SCOPe 2.08