Lineage for d1qeza_ (1qez A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14283Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 14284Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
  6. 14285Protein Inorganic pyrophosphatase [50326] (4 species)
  7. 14322Species Sulfolobus acidocaldarius [TaxId:330779] [50328] (1 PDB entry)
  8. 14323Domain d1qeza_: 1qez A: [25410]

Details for d1qeza_

PDB Entry: 1qez (more details), 2.7 Å

PDB Description: sulfolobus acidocaldarius inorganic pyrophosphatase: an archael pyrophosphatase.

SCOP Domain Sequences for d1qeza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qeza_ b.40.5.1 (A:) Inorganic pyrophosphatase {Sulfolobus acidocaldarius}
klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg

SCOP Domain Coordinates for d1qeza_:

Click to download the PDB-style file with coordinates for d1qeza_.
(The format of our PDB-style files is described here.)

Timeline for d1qeza_: