Lineage for d1pyp__ (1pyp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14283Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 14284Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
  6. 14285Protein Inorganic pyrophosphatase [50326] (4 species)
  7. 14286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (8 PDB entries)
  8. 14301Domain d1pyp__: 1pyp - [25409]

Details for d1pyp__

PDB Entry: 1pyp (more details), 3 Å

PDB Description: x-ray diffraction study of inorganic pyrophosphatase from baker,s yeast at the 3 angstroms resolution (russian)

SCOP Domain Sequences for d1pyp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyp__ b.40.5.1 (-) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae)}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
ltnvtlpdtptyskaasdaippaspkadapidksidkwffi

SCOP Domain Coordinates for d1pyp__:

Click to download the PDB-style file with coordinates for d1pyp__.
(The format of our PDB-style files is described here.)

Timeline for d1pyp__: