SCOPe 2.04: Domain d4p31b_: 4p31 B:

Lineage for d4p31b_ (4p31 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231728] (4 PDB entries)

8. Domain d4p31b_: 4p31 B: [254068]
   automated match to d4p32a_
   complexed with adp, mg

Details for d4p31b_

PDB Entry: 4p31, 2.05 Å

PDB Description: crystal structure of a selenomethionine derivative of e. coli lptb in complex with adp-magensium

PDB Compounds: (B:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d4p31b_:

Sequence; same for both SEQRES and ATOM records:

>d4p31b_ c.37.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvk

Timeline for d4p31b_:

• d4p31b_ is new in SCOPe 2.04-stable
  
• d4p31b_ appears in SCOPe 2.05
  
• d4p31b_ appears in the current release, SCOPe 2.08