![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries) |
![]() | Domain d4p31b_: 4p31 B: [254068] automated match to d4p32a_ complexed with adp, mg |
PDB Entry: 4p31 (more details), 2.05 Å
SCOPe Domain Sequences for d4p31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p31b_ c.37.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvk
Timeline for d4p31b_: