Lineage for d4ogna_ (4ogn A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735235Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1735236Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1735237Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 1735244Protein MDM2 [47594] (2 species)
  7. 1735262Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)
  8. 1735266Domain d4ogna_: 4ogn A: [254058]
    automated match to d4odea_
    complexed with 2u5, so4

Details for d4ogna_

PDB Entry: 4ogn (more details), 1.38 Å

PDB Description: co-crystal structure of mdm2 with inhbitor compound 3
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4ogna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogna_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
dgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydek
qqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4ogna_:

Click to download the PDB-style file with coordinates for d4ogna_.
(The format of our PDB-style files is described here.)

Timeline for d4ogna_: