SCOPe 2.05: Domain d4og2b_: 4og2 B:

Lineage for d4og2b_ (4og2 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (60 species)
   not a true protein

7. Species Anabaena variabilis [TaxId:240292] [256373] (9 PDB entries)

8. Domain d4og2b_: 4og2 B: [254057]
   automated match to d3ipca_
   complexed with cl, leu, mg; mutant

Details for d4og2b_

PDB Entry: 4og2, 1.1 Å

PDB Description: The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with leucine

PDB Compounds: (B:) Amino acid/amide ABC transporter substrate-binding protein, HAAT family

SCOPe Domain Sequences for d4og2b_:

Sequence; same for both SEQRES and ATOM records:

>d4og2b_ c.93.1.0 (B:) automated matches {Anabaena variabilis [TaxId: 240292]}
ntipigialaqtsnvallgqeqvagakiaekyfndkggvngtpiklifqdtagdeagtin
afqtlinkdkvvgivgptlsqqafsanpiaerakvpvvgpsntakgipeigdyvarvsap
vsvvapnsvkaalkqnpnikkvavffaqndafskseteifqqtvkdqglelvtvqkfqtt
dtdfqsqatnainlkpdlviisglaadggnlvrqlrelgyqgaiiggdglntsnvfavck
alcdgvliaqayspeytgeinkafrqayvdqykkeppqfsaqafaavqvyveslkaldtk
nkvskiqlpelrtelnkqlltgkyntplgeisftpigevvqkdfyvaqikmekdgsqgkf
tflk

Timeline for d4og2b_:

• d4og2b_ first appeared in SCOPe 2.04
  
• d4og2b_ appears in SCOPe 2.06
  
• d4og2b_ appears in the current release, SCOPe 2.08