Lineage for d4oatb_ (4oat B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624763Species Anabaena variabilis [TaxId:240292] [256373] (9 PDB entries)
  8. 1624773Domain d4oatb_: 4oat B: [254044]
    automated match to d3ipca_
    complexed with cl, ile, mg; mutant

Details for d4oatb_

PDB Entry: 4oat (more details), 1.2 Å

PDB Description: The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with isoleucine.
PDB Compounds: (B:) Amino acid/amide ABC transporter substrate-binding protein, HAAT family

SCOPe Domain Sequences for d4oatb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oatb_ c.93.1.0 (B:) automated matches {Anabaena variabilis [TaxId: 240292]}
ntipigialaqtsnvallgqeqvagakiaekyfndkggvngtpiklifqdtagdeagtin
afqtlinkdkvvgivgptlsqqafsanpiaerakvpvvgpsntakgipeigdyvarvsap
vsvvapnsvkaalkqnpnikkvavffaqndafskseteifqqtvkdqglelvtvqkfqtt
dtdfqsqatnainlkpdlviisglaadggnlvrqlrelgyqgaiiggdglntsnvfavck
alcdgvliaqayspeytgeinkafrqayvdqykkeppqfsaqafaavqvyveslkaldtk
nkvskiqlpelrtelnkqlltgkyntplgeisftpigevvqkdfyvaqikmekdgsqgkf
tflk

SCOPe Domain Coordinates for d4oatb_:

Click to download the PDB-style file with coordinates for d4oatb_.
(The format of our PDB-style files is described here.)

Timeline for d4oatb_: