Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
Protein automated matches [254423] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255207] (7 PDB entries) |
Domain d4ny0b2: 4ny0 B:131-253 [254035] Other proteins in same PDB: d4ny0a1, d4ny0a3, d4ny0b1, d4ny0b3, d4ny0d1, d4ny0d3 automated match to d2al6a1 |
PDB Entry: 4ny0 (more details), 2.8 Å
SCOPe Domain Sequences for d4ny0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ny0b2 a.11.2.0 (B:131-253) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgflnqftedkptlnffyqqvksdymleiadqvdqeialklgcleirrsygemrgnalek ksnyevlekdvglkrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv yrf
Timeline for d4ny0b2: