SCOPe 2.08: Domain d1huja_: 1huj A:

Lineage for d1huja_ (1huj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (9 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries)

8. Domain d1huja_: 1huj A: [25403]
   complexed with mg; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1huja_

PDB Entry: 1huj, 2.1 Å

PDB Description: refined structure of yeast inorganic pyrophosphatase and its k61r mutant

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1huja_:

Sequence; same for both SEQRES and ATOM records:

>d1huja_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
reetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwff

Timeline for d1huja_:

• d1huja_ first appeared (with stable ids) in SCOP 1.55
  
• d1huja_ appears in SCOPe 2.07