SCOPe 2.05: Domain d4nryb2: 4nry B:108-211

Lineage for d4nryb2 (4nry B:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4nryb2: 4nry B:108-211 [254021]
   automated match to d1h3pl2

Details for d4nryb2

PDB Entry: 4nry, 3.14 Å

PDB Description: crystal structure of hiv-1 neutralizing antibody m66

PDB Compounds: (B:) m66 Heavy Chain

SCOPe Domain Sequences for d4nryb2:

Sequence, based on SEQRES records:

>d4nryb2 b.1.1.0 (B:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d4nryb2 b.1.1.0 (B:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnsqesvteqdskdsty
slsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4nryb2:

• d4nryb2 first appeared in SCOPe 2.04
  
• d4nryb2 appears in SCOPe 2.06
  
• d4nryb2 appears in the current release, SCOPe 2.08