SCOPe 2.06: Domain d4nryb1: 4nry B:1-107

Lineage for d4nryb1 (4nry B:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4nryb1: 4nry B:1-107 [254020]
   automated match to d1h3pl1

Details for d4nryb1

PDB Entry: 4nry, 3.14 Å

PDB Description: crystal structure of hiv-1 neutralizing antibody m66

PDB Compounds: (B:) m66 Heavy Chain

SCOPe Domain Sequences for d4nryb1:

Sequence; same for both SEQRES and ATOM records:

>d4nryb1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtitcrasqsigsylnwyqqkpgkapklliyaastlqsgvps
rfsgsgsgtdftltisslqpedsatyycqqsystpftfgpgtkvdir

Timeline for d4nryb1:

• d4nryb1 first appeared in SCOPe 2.04
  
• d4nryb1 appears in SCOPe 2.05
  
• d4nryb1 appears in SCOPe 2.07
  
• d4nryb1 appears in the current release, SCOPe 2.08