Lineage for d4nrjf_ (4nrj F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645911Species Influenza B virus [TaxId:107412] [256374] (3 PDB entries)
  8. 2645914Domain d4nrjf_: 4nrj F: [254019]
    Other proteins in same PDB: d4nrja_, d4nrjc_, d4nrje_
    automated match to d1ti8b1
    complexed with nag; mutant

Details for d4nrjf_

PDB Entry: 4nrj (more details), 2.53 Å

PDB Description: structure of hemagglutinin with f95y mutation of influenza virus b/lee/40
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4nrjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrjf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza B virus [TaxId: 107412]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamnelhdeileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsaveigngcfetkhkcnqtcldriaagtfnagdfslptfd

SCOPe Domain Coordinates for d4nrjf_:

Click to download the PDB-style file with coordinates for d4nrjf_.
(The format of our PDB-style files is described here.)

Timeline for d4nrjf_: